Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,789
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 12,695
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 12,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 12,556
  5. Avatar for Go Science 5. Go Science 29 pts. 12,460
  6. Avatar for Contenders 6. Contenders 20 pts. 12,414
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,381
  8. Avatar for Russian team 8. Russian team 9 pts. 12,197
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 12,051
  10. Avatar for Hold My Beer 10. Hold My Beer 4 pts. 11,905
  1. Avatar for toshiue 11. toshiue Lv 1 2 pts. 12,459
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 1 pt. 12,396
  3. Avatar for actiasluna 13. actiasluna Lv 1 1 pt. 12,381
  4. Avatar for Keresto 14. Keresto Lv 1 1 pt. 12,352
  5. Avatar for silent gene 15. silent gene Lv 1 1 pt. 12,349
  6. Avatar for Willyanto 16. Willyanto Lv 1 1 pt. 12,152
  7. Avatar for Anfinsen_slept_here 17. Anfinsen_slept_here Lv 1 1 pt. 12,061
  8. Avatar for Blipperman 18. Blipperman Lv 1 1 pt. 11,814

Comments