Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for boondog 91. boondog Lv 1 1 pt. 10,184
  2. Avatar for JasperD 92. JasperD Lv 1 1 pt. 10,182
  3. Avatar for Dantoto 93. Dantoto Lv 1 1 pt. 10,161
  4. Avatar for Anamfija 94. Anamfija Lv 1 1 pt. 10,157
  5. Avatar for SLYHPM 95. SLYHPM Lv 1 1 pt. 10,142
  6. Avatar for Silvercraft 96. Silvercraft Lv 1 1 pt. 10,120
  7. Avatar for multaq 97. multaq Lv 1 1 pt. 10,051
  8. Avatar for Simek 98. Simek Lv 1 1 pt. 9,964
  9. Avatar for hajtogato 99. hajtogato Lv 1 1 pt. 9,950
  10. Avatar for brucefold 100. brucefold Lv 1 1 pt. 9,914

Comments