Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for boondog 91. boondog Lv 1 1 pt. 10,184
  2. Avatar for JasperD 92. JasperD Lv 1 1 pt. 10,182
  3. Avatar for Dantoto 93. Dantoto Lv 1 1 pt. 10,161
  4. Avatar for Anamfija 94. Anamfija Lv 1 1 pt. 10,157
  5. Avatar for SLYHPM 95. SLYHPM Lv 1 1 pt. 10,142
  6. Avatar for Silvercraft 96. Silvercraft Lv 1 1 pt. 10,120
  7. Avatar for multaq 97. multaq Lv 1 1 pt. 10,051
  8. Avatar for Simek 98. Simek Lv 1 1 pt. 9,964
  9. Avatar for hajtogato 99. hajtogato Lv 1 1 pt. 9,950
  10. Avatar for brucefold 100. brucefold Lv 1 1 pt. 9,914

Comments