Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for polymorphicchanges 101. polymorphicchanges Lv 1 1 pt. 9,865
  2. Avatar for ScyllaHide 102. ScyllaHide Lv 1 1 pt. 9,843
  3. Avatar for 15SecNut 103. 15SecNut Lv 1 1 pt. 9,788
  4. Avatar for DipsyDoodle2016 104. DipsyDoodle2016 Lv 1 1 pt. 9,705
  5. Avatar for RayQuartum 105. RayQuartum Lv 1 1 pt. 9,703
  6. Avatar for LanceKnight26 106. LanceKnight26 Lv 1 1 pt. 9,546
  7. Avatar for RockOn 107. RockOn Lv 1 1 pt. 9,483
  8. Avatar for kitek314_pl 108. kitek314_pl Lv 1 1 pt. 9,470
  9. Avatar for TotallyBionic 109. TotallyBionic Lv 1 1 pt. 9,445
  10. Avatar for jamiexq 110. jamiexq Lv 1 1 pt. 9,389

Comments