Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 24 pts. 11,346
  2. Avatar for grogar7 32. grogar7 Lv 1 22 pts. 11,304
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 21 pts. 11,282
  4. Avatar for joremen 34. joremen Lv 1 20 pts. 11,278
  5. Avatar for Alistair69 35. Alistair69 Lv 1 19 pts. 11,262
  6. Avatar for Idiotboy 36. Idiotboy Lv 1 18 pts. 11,202
  7. Avatar for Merf 37. Merf Lv 1 17 pts. 11,200
  8. Avatar for gurch 38. gurch Lv 1 16 pts. 11,194
  9. Avatar for PeterDav 39. PeterDav Lv 1 15 pts. 11,188
  10. Avatar for alcor29 40. alcor29 Lv 1 14 pts. 11,187

Comments