Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 24 pts. 11,346
  2. Avatar for grogar7 32. grogar7 Lv 1 22 pts. 11,304
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 21 pts. 11,282
  4. Avatar for joremen 34. joremen Lv 1 20 pts. 11,278
  5. Avatar for Alistair69 35. Alistair69 Lv 1 19 pts. 11,262
  6. Avatar for Idiotboy 36. Idiotboy Lv 1 18 pts. 11,202
  7. Avatar for Merf 37. Merf Lv 1 17 pts. 11,200
  8. Avatar for gurch 38. gurch Lv 1 16 pts. 11,194
  9. Avatar for PeterDav 39. PeterDav Lv 1 15 pts. 11,188
  10. Avatar for alcor29 40. alcor29 Lv 1 14 pts. 11,187

Comments