Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for heather-1 41. heather-1 Lv 1 13 pts. 11,142
  2. Avatar for toshiue 42. toshiue Lv 1 12 pts. 11,105
  3. Avatar for xbp 43. xbp Lv 1 12 pts. 11,092
  4. Avatar for Arne Heessels 44. Arne Heessels Lv 1 11 pts. 11,087
  5. Avatar for stomjoh 45. stomjoh Lv 1 10 pts. 11,076
  6. Avatar for Deleted player 46. Deleted player 10 pts. 11,054
  7. Avatar for highfive 47. highfive Lv 1 9 pts. 11,040
  8. Avatar for Amphimixus 48. Amphimixus Lv 1 8 pts. 10,991
  9. Avatar for DoctorSockrates 49. DoctorSockrates Lv 1 8 pts. 10,961
  10. Avatar for Altercomp 50. Altercomp Lv 1 7 pts. 10,959

Comments