Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for heather-1 41. heather-1 Lv 1 13 pts. 11,142
  2. Avatar for toshiue 42. toshiue Lv 1 12 pts. 11,105
  3. Avatar for xbp 43. xbp Lv 1 12 pts. 11,092
  4. Avatar for Arne Heessels 44. Arne Heessels Lv 1 11 pts. 11,087
  5. Avatar for stomjoh 45. stomjoh Lv 1 10 pts. 11,076
  6. Avatar for Deleted player 46. Deleted player 10 pts. 11,054
  7. Avatar for highfive 47. highfive Lv 1 9 pts. 11,040
  8. Avatar for Amphimixus 48. Amphimixus Lv 1 8 pts. 10,991
  9. Avatar for DoctorSockrates 49. DoctorSockrates Lv 1 8 pts. 10,961
  10. Avatar for Altercomp 50. Altercomp Lv 1 7 pts. 10,959

Comments