Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for Wipf 51. Wipf Lv 1 7 pts. 10,958
  2. Avatar for pfirth 52. pfirth Lv 1 6 pts. 10,913
  3. Avatar for TastyMunchies 53. TastyMunchies Lv 1 6 pts. 10,892
  4. Avatar for jausmh 54. jausmh Lv 1 6 pts. 10,886
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 5 pts. 10,879
  6. Avatar for libellule 56. libellule Lv 1 5 pts. 10,869
  7. Avatar for Bobnine 57. Bobnine Lv 1 5 pts. 10,860
  8. Avatar for Aminal88 58. Aminal88 Lv 1 4 pts. 10,855
  9. Avatar for anthion 59. anthion Lv 1 4 pts. 10,848
  10. Avatar for rezaefar 60. rezaefar Lv 1 4 pts. 10,829

Comments