Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for Wipf 51. Wipf Lv 1 7 pts. 10,958
  2. Avatar for pfirth 52. pfirth Lv 1 6 pts. 10,913
  3. Avatar for TastyMunchies 53. TastyMunchies Lv 1 6 pts. 10,892
  4. Avatar for jausmh 54. jausmh Lv 1 6 pts. 10,886
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 5 pts. 10,879
  6. Avatar for libellule 56. libellule Lv 1 5 pts. 10,869
  7. Avatar for Bobnine 57. Bobnine Lv 1 5 pts. 10,860
  8. Avatar for Aminal88 58. Aminal88 Lv 1 4 pts. 10,855
  9. Avatar for anthion 59. anthion Lv 1 4 pts. 10,848
  10. Avatar for rezaefar 60. rezaefar Lv 1 4 pts. 10,829

Comments