Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572
  1. Avatar for boondog 101. boondog Lv 1 1 pt. 6,287
  2. Avatar for pioneer_round 102. pioneer_round Lv 1 1 pt. 6,197
  3. Avatar for Amsterdamaged 103. Amsterdamaged Lv 1 1 pt. 6,186
  4. Avatar for stephendl102 104. stephendl102 Lv 1 1 pt. 6,156
  5. Avatar for donuts554 105. donuts554 Lv 1 1 pt. 6,084
  6. Avatar for Ciccillo 106. Ciccillo Lv 1 1 pt. 6,001
  7. Avatar for sherryme 107. sherryme Lv 1 1 pt. 5,892
  8. Avatar for ikemori 108. ikemori Lv 1 1 pt. 4,889
  9. Avatar for xardasmat 109. xardasmat Lv 1 1 pt. 4,883
  10. Avatar for Alpha-KetoGlutarate1301 110. Alpha-KetoGlutarate1301 Lv 1 1 pt. 4,672

Comments