Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572
  1. Avatar for robgee 11. robgee Lv 1 64 pts. 11,036
  2. Avatar for frood66 12. frood66 Lv 1 62 pts. 11,033
  3. Avatar for Deleted player 13. Deleted player pts. 11,029
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 56 pts. 11,029
  5. Avatar for pvc78 15. pvc78 Lv 1 53 pts. 11,004
  6. Avatar for Museka 16. Museka Lv 1 51 pts. 11,000
  7. Avatar for crpainter 17. crpainter Lv 1 48 pts. 10,990
  8. Avatar for O Seki To 18. O Seki To Lv 1 46 pts. 10,989
  9. Avatar for Galaxie 19. Galaxie Lv 1 44 pts. 10,987
  10. Avatar for Keresto 20. Keresto Lv 1 42 pts. 10,984

Comments