Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Beta Folders 100 pts. 11,200
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 11,167
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,125
  4. Avatar for Go Science 4. Go Science 36 pts. 11,118
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 11,076
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 11,073
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 11,029
  8. Avatar for Contenders 8. Contenders 6 pts. 10,990
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,989
  10. Avatar for Russian team 10. Russian team 2 pts. 10,855

  1. Avatar for robgee 11. robgee Lv 1 64 pts. 11,036
  2. Avatar for frood66 12. frood66 Lv 1 62 pts. 11,033
  3. Avatar for Deleted player 13. Deleted player pts. 11,029
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 56 pts. 11,029
  5. Avatar for pvc78 15. pvc78 Lv 1 53 pts. 11,004
  6. Avatar for Museka 16. Museka Lv 1 51 pts. 11,000
  7. Avatar for crpainter 17. crpainter Lv 1 48 pts. 10,990
  8. Avatar for O Seki To 18. O Seki To Lv 1 46 pts. 10,989
  9. Avatar for Galaxie 19. Galaxie Lv 1 44 pts. 10,987
  10. Avatar for Keresto 20. Keresto Lv 1 42 pts. 10,984

Comments