Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572
  1. Avatar for drumpeter18yrs9yrs 31. drumpeter18yrs9yrs Lv 1 23 pts. 10,787
  2. Avatar for TastyMunchies 32. TastyMunchies Lv 1 22 pts. 10,778
  3. Avatar for johnmitch 33. johnmitch Lv 1 21 pts. 10,723
  4. Avatar for georg137 34. georg137 Lv 1 20 pts. 10,693
  5. Avatar for Vinara 35. Vinara Lv 1 18 pts. 10,662
  6. Avatar for tarimo 36. tarimo Lv 1 17 pts. 10,658
  7. Avatar for fpc 37. fpc Lv 1 16 pts. 10,650
  8. Avatar for Deleted player 38. Deleted player 15 pts. 10,618
  9. Avatar for WBarme1234 39. WBarme1234 Lv 1 15 pts. 10,617
  10. Avatar for phi16 40. phi16 Lv 1 14 pts. 10,584

Comments