Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,200
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 11,167
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,125
  4. Avatar for Go Science 4. Go Science 36 pts. 11,118
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 11,076
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 11,073
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 11,029
  8. Avatar for Contenders 8. Contenders 6 pts. 10,990
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,989
  10. Avatar for Russian team 10. Russian team 2 pts. 10,855
  1. Avatar for drumpeter18yrs9yrs 31. drumpeter18yrs9yrs Lv 1 23 pts. 10,787
  2. Avatar for TastyMunchies 32. TastyMunchies Lv 1 22 pts. 10,778
  3. Avatar for johnmitch 33. johnmitch Lv 1 21 pts. 10,723
  4. Avatar for georg137 34. georg137 Lv 1 20 pts. 10,693
  5. Avatar for Vinara 35. Vinara Lv 1 18 pts. 10,662
  6. Avatar for tarimo 36. tarimo Lv 1 17 pts. 10,658
  7. Avatar for fpc 37. fpc Lv 1 16 pts. 10,650
  8. Avatar for Deleted player 38. Deleted player 15 pts. 10,618
  9. Avatar for WBarme1234 39. WBarme1234 Lv 1 15 pts. 10,617
  10. Avatar for phi16 40. phi16 Lv 1 14 pts. 10,584

Comments