Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791

  1. Avatar for WUMAO 91. WUMAO Lv 1 1 pt. 10,814
  2. Avatar for CNCQJJ 92. CNCQJJ Lv 1 1 pt. 10,811
  3. Avatar for hajtogato 93. hajtogato Lv 1 1 pt. 10,807
  4. Avatar for ntmorris21 94. ntmorris21 Lv 1 1 pt. 10,802
  5. Avatar for alyssa_d 95. alyssa_d Lv 1 1 pt. 10,791
  6. Avatar for abiogenesis 96. abiogenesis Lv 1 1 pt. 10,787
  7. Avatar for bmate 97. bmate Lv 1 1 pt. 10,784
  8. Avatar for Dj-P 98. Dj-P Lv 1 1 pt. 10,770
  9. Avatar for Ciccillo 99. Ciccillo Lv 1 1 pt. 10,753
  10. Avatar for minhhungtuan 100. minhhungtuan Lv 1 1 pt. 10,698

Comments