Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791

  1. Avatar for johnmitch 11. johnmitch Lv 1 63 pts. 11,662
  2. Avatar for O Seki To 12. O Seki To Lv 1 60 pts. 11,652
  3. Avatar for crpainter 13. crpainter Lv 1 58 pts. 11,651
  4. Avatar for Phyx 14. Phyx Lv 1 55 pts. 11,650
  5. Avatar for LociOiling 15. LociOiling Lv 1 52 pts. 11,648
  6. Avatar for Deleted player 16. Deleted player pts. 11,642
  7. Avatar for joremen 17. joremen Lv 1 47 pts. 11,634
  8. Avatar for robgee 18. robgee Lv 1 45 pts. 11,624
  9. Avatar for Norrjane 19. Norrjane Lv 1 42 pts. 11,614
  10. Avatar for frood66 20. frood66 Lv 1 40 pts. 11,609

Comments