Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791
  1. Avatar for vakobo 21. vakobo Lv 1 38 pts. 11,597
  2. Avatar for guineapig 22. guineapig Lv 1 36 pts. 11,596
  3. Avatar for silent gene 23. silent gene Lv 1 34 pts. 11,594
  4. Avatar for phi16 24. phi16 Lv 1 33 pts. 11,572
  5. Avatar for grogar7 25. grogar7 Lv 1 31 pts. 11,570
  6. Avatar for anthion 26. anthion Lv 1 29 pts. 11,565
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 28 pts. 11,565
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 26 pts. 11,553
  9. Avatar for kitek314_pl 29. kitek314_pl Lv 1 25 pts. 11,551
  10. Avatar for PeterDav 30. PeterDav Lv 1 23 pts. 11,551

Comments