Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 22 pts. 11,526
  2. Avatar for fiendish_ghoul 32. fiendish_ghoul Lv 1 21 pts. 11,516
  3. Avatar for WBarme1234 33. WBarme1234 Lv 1 19 pts. 11,508
  4. Avatar for vuvuvu 34. vuvuvu Lv 1 18 pts. 11,505
  5. Avatar for mberna00 35. mberna00 Lv 1 17 pts. 11,495
  6. Avatar for Merf 36. Merf Lv 1 16 pts. 11,489
  7. Avatar for alcor29 37. alcor29 Lv 1 15 pts. 11,489
  8. Avatar for georg137 38. georg137 Lv 1 14 pts. 11,477
  9. Avatar for jausmh 39. jausmh Lv 1 13 pts. 11,467
  10. Avatar for Cloudy101 40. Cloudy101 Lv 1 13 pts. 11,462

Comments