Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791
  1. Avatar for fpc 41. fpc Lv 1 12 pts. 11,454
  2. Avatar for rezaefar 42. rezaefar Lv 1 11 pts. 11,453
  3. Avatar for diamonddays 43. diamonddays Lv 1 10 pts. 11,443
  4. Avatar for ReallyRatherDumb 44. ReallyRatherDumb Lv 1 10 pts. 11,416
  5. Avatar for Silvercraft 45. Silvercraft Lv 1 9 pts. 11,414
  6. Avatar for Museka 46. Museka Lv 1 8 pts. 11,398
  7. Avatar for martin.kendig@verizon.net 47. martin.kendig@verizon.net Lv 1 8 pts. 11,391
  8. Avatar for Vinara 48. Vinara Lv 1 7 pts. 11,383
  9. Avatar for cobaltteal 49. cobaltteal Lv 1 7 pts. 11,382
  10. Avatar for heather-1 50. heather-1 Lv 1 6 pts. 11,371

Comments