Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791
  1. Avatar for NotJim99 51. NotJim99 Lv 1 6 pts. 11,357
  2. Avatar for frostschutz 52. frostschutz Lv 1 5 pts. 11,315
  3. Avatar for Aminal88 53. Aminal88 Lv 1 5 pts. 11,313
  4. Avatar for Pawel Tluscik 54. Pawel Tluscik Lv 1 5 pts. 11,313
  5. Avatar for VojtenziCZE 55. VojtenziCZE Lv 1 4 pts. 11,310
  6. Avatar for godel9 56. godel9 Lv 1 4 pts. 11,295
  7. Avatar for Keresto 57. Keresto Lv 1 4 pts. 11,287
  8. Avatar for rabamino12358 58. rabamino12358 Lv 1 3 pts. 11,253
  9. Avatar for gurch 59. gurch Lv 1 3 pts. 11,249
  10. Avatar for jamiexq 60. jamiexq Lv 1 3 pts. 11,246

Comments