Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791

  1. Avatar for Altercomp 61. Altercomp Lv 1 3 pts. 11,235
  2. Avatar for neon_fuzz 62. neon_fuzz Lv 1 3 pts. 11,231
  3. Avatar for 181818 63. 181818 Lv 1 2 pts. 11,226
  4. Avatar for pfirth 64. pfirth Lv 1 2 pts. 11,187
  5. Avatar for Artoria2e5 65. Artoria2e5 Lv 1 2 pts. 11,180
  6. Avatar for Willyanto 66. Willyanto Lv 1 2 pts. 11,169
  7. Avatar for boondog 67. boondog Lv 1 2 pts. 11,155
  8. Avatar for Hellcat6 68. Hellcat6 Lv 1 2 pts. 11,151
  9. Avatar for Glen B 69. Glen B Lv 1 2 pts. 11,148
  10. Avatar for ManVsYard 70. ManVsYard Lv 1 1 pt. 11,103

Comments