Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791
  1. Avatar for cbwest 71. cbwest Lv 1 1 pt. 11,074
  2. Avatar for Arne Heessels 72. Arne Heessels Lv 1 1 pt. 11,012
  3. Avatar for Mike Cassidy 73. Mike Cassidy Lv 1 1 pt. 10,972
  4. Avatar for xbp 74. xbp Lv 1 1 pt. 10,949
  5. Avatar for kevin everington 75. kevin everington Lv 1 1 pt. 10,947
  6. Avatar for orily1337 76. orily1337 Lv 1 1 pt. 10,926
  7. Avatar for Foldomatic6396 77. Foldomatic6396 Lv 1 1 pt. 10,909
  8. Avatar for rinze 78. rinze Lv 1 1 pt. 10,904
  9. Avatar for drumpeter18yrs9yrs 79. drumpeter18yrs9yrs Lv 1 1 pt. 10,902
  10. Avatar for ausername123 80. ausername123 Lv 1 1 pt. 10,902

Comments