Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,128
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,106
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 9,972
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,351
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231
  1. Avatar for bohurt 91. bohurt Lv 1 1 pt. 9,501
  2. Avatar for jdmclure 92. jdmclure Lv 1 1 pt. 9,495
  3. Avatar for vamshianand 93. vamshianand Lv 1 1 pt. 9,490
  4. Avatar for Pomidor z cebulom 94. Pomidor z cebulom Lv 1 1 pt. 9,468
  5. Avatar for nerdyshygirl 95. nerdyshygirl Lv 1 1 pt. 9,462
  6. Avatar for Virulenzfaktor 96. Virulenzfaktor Lv 1 1 pt. 9,426
  7. Avatar for TePie 97. TePie Lv 1 1 pt. 9,405
  8. Avatar for CNCQJJ 98. CNCQJJ Lv 1 1 pt. 9,353
  9. Avatar for doctaven 99. doctaven Lv 1 1 pt. 9,351
  10. Avatar for Auntecedent 100. Auntecedent Lv 1 1 pt. 9,341

Comments