Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,128
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,106
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 9,972
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,351
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231
  1. Avatar for raygunds 101. raygunds Lv 1 1 pt. 9,331
  2. Avatar for lamoille 102. lamoille Lv 1 1 pt. 9,278
  3. Avatar for ourtown 103. ourtown Lv 1 1 pt. 9,263
  4. Avatar for ausername123 104. ausername123 Lv 1 1 pt. 9,238
  5. Avatar for alyssa_d 105. alyssa_d Lv 1 1 pt. 9,231
  6. Avatar for wackadoo 106. wackadoo Lv 1 1 pt. 9,223
  7. Avatar for Puttering 107. Puttering Lv 1 1 pt. 9,207
  8. Avatar for franzemanz 108. franzemanz Lv 1 1 pt. 9,204
  9. Avatar for 01010011111 109. 01010011111 Lv 1 1 pt. 9,001
  10. Avatar for harvardman 110. harvardman Lv 1 1 pt. 8,523

Comments