Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,128
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,106
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 9,972
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,351
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231
  1. Avatar for O Seki To 11. O Seki To Lv 1 63 pts. 10,209
  2. Avatar for joremen 12. joremen Lv 1 60 pts. 10,206
  3. Avatar for Deleted player 13. Deleted player 58 pts. 10,200
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 55 pts. 10,200
  5. Avatar for anthion 15. anthion Lv 1 52 pts. 10,195
  6. Avatar for robgee 16. robgee Lv 1 50 pts. 10,191
  7. Avatar for nicobul 17. nicobul Lv 1 47 pts. 10,190
  8. Avatar for actiasluna 18. actiasluna Lv 1 45 pts. 10,189
  9. Avatar for pvc78 19. pvc78 Lv 1 42 pts. 10,186
  10. Avatar for frood66 20. frood66 Lv 1 40 pts. 10,185

Comments