Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,128
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,106
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 9,972
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,351
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231
  1. Avatar for PeterDav 31. PeterDav Lv 1 22 pts. 10,149
  2. Avatar for jausmh 32. jausmh Lv 1 21 pts. 10,145
  3. Avatar for guineapig 33. guineapig Lv 1 19 pts. 10,143
  4. Avatar for vuvuvu 34. vuvuvu Lv 1 18 pts. 10,128
  5. Avatar for alcor29 35. alcor29 Lv 1 17 pts. 10,127
  6. Avatar for diamonddays 36. diamonddays Lv 1 16 pts. 10,126
  7. Avatar for Threeoak 37. Threeoak Lv 1 15 pts. 10,123
  8. Avatar for georg137 38. georg137 Lv 1 14 pts. 10,111
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 13 pts. 10,106
  10. Avatar for kitek314_pl 40. kitek314_pl Lv 1 13 pts. 10,106

Comments