Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,128
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,106
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 9,972
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,351
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231

  1. Avatar for manu8170 51. manu8170 Lv 1 6 pts. 10,003
  2. Avatar for Vinara 52. Vinara Lv 1 5 pts. 9,992
  3. Avatar for Aminal88 53. Aminal88 Lv 1 5 pts. 9,972
  4. Avatar for Pawel Tluscik 54. Pawel Tluscik Lv 1 5 pts. 9,971
  5. Avatar for fpc 55. fpc Lv 1 4 pts. 9,964
  6. Avatar for Altercomp 56. Altercomp Lv 1 4 pts. 9,937
  7. Avatar for VojtenziCZE 57. VojtenziCZE Lv 1 4 pts. 9,930
  8. Avatar for frostschutz 58. frostschutz Lv 1 3 pts. 9,911
  9. Avatar for drumpeter18yrs9yrs 59. drumpeter18yrs9yrs Lv 1 3 pts. 9,903
  10. Avatar for rabamino12358 60. rabamino12358 Lv 1 3 pts. 9,886

Comments