Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,152
  2. Avatar for Russian team 12. Russian team 1 pt. 10,140
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,598

  1. Avatar for Rus 101. Rus Lv 1 1 pt. 9,007
  2. Avatar for ManVsYard 102. ManVsYard Lv 1 1 pt. 8,768
  3. Avatar for goodger 103. goodger Lv 1 1 pt. 7,996
  4. Avatar for QuanEvans 104. QuanEvans Lv 1 1 pt. 7,599
  5. Avatar for harvardman 105. harvardman Lv 1 1 pt. 5,726
  6. Avatar for 01010011111 106. 01010011111 Lv 1 1 pt. 5,589
  7. Avatar for Silvercraft 107. Silvercraft Lv 1 1 pt. 4,065
  8. Avatar for asd456 108. asd456 Lv 1 1 pt. 2,980
  9. Avatar for momadoc 109. momadoc Lv 1 1 pt. 2,966

Comments