Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,490
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,465
  3. Avatar for Go Science 3. Go Science 41 pts. 10,406
  4. Avatar for HMT heritage 4. HMT heritage 24 pts. 10,357
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,336
  6. Avatar for Contenders 6. Contenders 7 pts. 10,325
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 10,313
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,313
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 10,308
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 10,217
  1. Avatar for Rus 101. Rus Lv 1 1 pt. 9,007
  2. Avatar for ManVsYard 102. ManVsYard Lv 1 1 pt. 8,768
  3. Avatar for goodger 103. goodger Lv 1 1 pt. 7,996
  4. Avatar for QuanEvans 104. QuanEvans Lv 1 1 pt. 7,599
  5. Avatar for harvardman 105. harvardman Lv 1 1 pt. 5,726
  6. Avatar for 01010011111 106. 01010011111 Lv 1 1 pt. 5,589
  7. Avatar for Silvercraft 107. Silvercraft Lv 1 1 pt. 4,065
  8. Avatar for asd456 108. asd456 Lv 1 1 pt. 2,980
  9. Avatar for momadoc 109. momadoc Lv 1 1 pt. 2,966

Comments