Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,152
  2. Avatar for Russian team 12. Russian team 1 pt. 10,140
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,598

  1. Avatar for rinze 81. rinze Lv 1 1 pt. 9,515
  2. Avatar for abiogenesis 82. abiogenesis Lv 1 1 pt. 9,509
  3. Avatar for Artoria2e5 83. Artoria2e5 Lv 1 1 pt. 9,509
  4. Avatar for 181818 84. 181818 Lv 1 1 pt. 9,507
  5. Avatar for pacheco4102 85. pacheco4102 Lv 1 1 pt. 9,495
  6. Avatar for kubek915 86. kubek915 Lv 1 1 pt. 9,341
  7. Avatar for multaq 88. multaq Lv 1 1 pt. 9,259
  8. Avatar for Vincera 89. Vincera Lv 1 1 pt. 9,258
  9. Avatar for RileyBugz1 90. RileyBugz1 Lv 1 1 pt. 9,241

Comments