Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,490
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,465
  3. Avatar for Go Science 3. Go Science 41 pts. 10,406
  4. Avatar for HMT heritage 4. HMT heritage 24 pts. 10,357
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,336
  6. Avatar for Contenders 6. Contenders 7 pts. 10,325
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 10,313
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,313
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 10,308
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 10,217
  1. Avatar for rinze 81. rinze Lv 1 1 pt. 9,515
  2. Avatar for abiogenesis 82. abiogenesis Lv 1 1 pt. 9,509
  3. Avatar for Artoria2e5 83. Artoria2e5 Lv 1 1 pt. 9,509
  4. Avatar for 181818 84. 181818 Lv 1 1 pt. 9,507
  5. Avatar for pacheco4102 85. pacheco4102 Lv 1 1 pt. 9,495
  6. Avatar for kubek915 86. kubek915 Lv 1 1 pt. 9,341
  7. Avatar for fosfotrinucleotide 87. fosfotrinucleotide Lv 1 1 pt. 9,307
  8. Avatar for multaq 88. multaq Lv 1 1 pt. 9,259
  9. Avatar for Vincera 89. Vincera Lv 1 1 pt. 9,258
  10. Avatar for RileyBugz1 90. RileyBugz1 Lv 1 1 pt. 9,241

Comments