Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,232
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,882
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,849
  4. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 6,987

  1. Avatar for Galaxie 21. Galaxie Lv 1 40 pts. 10,523
  2. Avatar for Merf 22. Merf Lv 1 38 pts. 10,499
  3. Avatar for joremen 23. joremen Lv 1 36 pts. 10,491
  4. Avatar for RockOn 25. RockOn Lv 1 32 pts. 10,477
  5. Avatar for vakobo 26. vakobo Lv 1 31 pts. 10,470
  6. Avatar for TastyMunchies 27. TastyMunchies Lv 1 29 pts. 10,468
  7. Avatar for Vinara 28. Vinara Lv 1 27 pts. 10,458
  8. Avatar for johnmitch 29. johnmitch Lv 1 26 pts. 10,457
  9. Avatar for pvc78 30. pvc78 Lv 1 25 pts. 10,455

Comments