Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for HMT heritage 100 pts. 10,728
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,719
  3. Avatar for Go Science 3. Go Science 47 pts. 10,696
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,643
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,633
  6. Avatar for Contenders 6. Contenders 11 pts. 10,561
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,532
  8. Avatar for Russian team 8. Russian team 4 pts. 10,470
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 10,466
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,439

  1. Avatar for Galaxie 21. Galaxie Lv 1 40 pts. 10,523
  2. Avatar for Merf 22. Merf Lv 1 38 pts. 10,499
  3. Avatar for joremen 23. joremen Lv 1 36 pts. 10,491
  4. Avatar for RockOn 25. RockOn Lv 1 32 pts. 10,477
  5. Avatar for vakobo 26. vakobo Lv 1 31 pts. 10,470
  6. Avatar for TastyMunchies 27. TastyMunchies Lv 1 29 pts. 10,468
  7. Avatar for Vinara 28. Vinara Lv 1 27 pts. 10,458
  8. Avatar for johnmitch 29. johnmitch Lv 1 26 pts. 10,457
  9. Avatar for pvc78 30. pvc78 Lv 1 25 pts. 10,455

Comments