Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,066
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  6. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025
  1. Avatar for WalrusMcFishSr 91. WalrusMcFishSr Lv 1 1 pt. 8,969
  2. Avatar for Artoria2e5 92. Artoria2e5 Lv 1 1 pt. 8,962
  3. Avatar for Albatross795 93. Albatross795 Lv 1 1 pt. 8,956
  4. Avatar for fosfotrinucleotide 94. fosfotrinucleotide Lv 1 1 pt. 8,884
  5. Avatar for Hellcat6 95. Hellcat6 Lv 1 1 pt. 8,869
  6. Avatar for DragosDabu 96. DragosDabu Lv 1 1 pt. 8,868
  7. Avatar for alyssa_d_V2.0 97. alyssa_d_V2.0 Lv 1 1 pt. 8,854
  8. Avatar for Auntecedent 98. Auntecedent Lv 1 1 pt. 8,827
  9. Avatar for sarevok 99. sarevok Lv 1 1 pt. 8,769
  10. Avatar for mernitka 100. mernitka Lv 1 1 pt. 8,756

Comments