Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Marvin's bunch 100 pts. 10,992
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,989
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,916
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,806
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,791
  6. Avatar for Go Science 6. Go Science 14 pts. 10,742
  7. Avatar for Contenders 7. Contenders 8 pts. 10,686
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,667
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,649
  10. Avatar for Russian team 10. Russian team 2 pts. 10,443

  1. Avatar for WalrusMcFishSr 91. WalrusMcFishSr Lv 1 1 pt. 8,969
  2. Avatar for Artoria2e5 92. Artoria2e5 Lv 1 1 pt. 8,962
  3. Avatar for Albatross795 93. Albatross795 Lv 1 1 pt. 8,956
  4. Avatar for Hellcat6 95. Hellcat6 Lv 1 1 pt. 8,869
  5. Avatar for DragosDabu 96. DragosDabu Lv 1 1 pt. 8,868
  6. Avatar for alyssa_d_V2.0 97. alyssa_d_V2.0 Lv 1 1 pt. 8,854
  7. Avatar for Auntecedent 98. Auntecedent Lv 1 1 pt. 8,827
  8. Avatar for sarevok 99. sarevok Lv 1 1 pt. 8,769
  9. Avatar for mernitka 100. mernitka Lv 1 1 pt. 8,756

Comments