Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,066
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  6. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025
  1. Avatar for gurch 111. gurch Lv 1 1 pt. 8,555
  2. Avatar for frostschutz 112. frostschutz Lv 1 1 pt. 8,523
  3. Avatar for heh mda 113. heh mda Lv 1 1 pt. 8,427
  4. Avatar for thesamster7 114. thesamster7 Lv 1 1 pt. 7,962
  5. Avatar for dundekzl 115. dundekzl Lv 1 1 pt. 7,816
  6. Avatar for xBIOCHEMISTx 116. xBIOCHEMISTx Lv 1 1 pt. 7,768
  7. Avatar for 01010011111 117. 01010011111 Lv 1 1 pt. 7,399
  8. Avatar for alegrot 118. alegrot Lv 1 1 pt. 3,025
  9. Avatar for Quynh 119. Quynh Lv 1 1 pt. 2,395
  10. Avatar for bkoep 120. bkoep Lv 1 1 pt. 1,747

Comments