Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Marvin's bunch 100 pts. 10,992
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,989
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,916
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,806
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,791
  6. Avatar for Go Science 6. Go Science 14 pts. 10,742
  7. Avatar for Contenders 7. Contenders 8 pts. 10,686
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,667
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,649
  10. Avatar for Russian team 10. Russian team 2 pts. 10,443

  1. Avatar for gurch 111. gurch Lv 1 1 pt. 8,555
  2. Avatar for frostschutz 112. frostschutz Lv 1 1 pt. 8,523
  3. Avatar for heh mda 113. heh mda Lv 1 1 pt. 8,427
  4. Avatar for thesamster7 114. thesamster7 Lv 1 1 pt. 7,962
  5. Avatar for dundekzl 115. dundekzl Lv 1 1 pt. 7,816
  6. Avatar for xBIOCHEMISTx 116. xBIOCHEMISTx Lv 1 1 pt. 7,768
  7. Avatar for 01010011111 117. 01010011111 Lv 1 1 pt. 7,399
  8. Avatar for alegrot 118. alegrot Lv 1 1 pt. 3,025
  9. Avatar for Quynh 119. Quynh Lv 1 1 pt. 2,395
  10. Avatar for bkoep 120. bkoep Lv 1 1 pt. 1,747

Comments