Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  5. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025

  1. Avatar for Idiotboy 11. Idiotboy Lv 1 65 pts. 10,697
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 62 pts. 10,687
  3. Avatar for crpainter 13. crpainter Lv 1 60 pts. 10,686
  4. Avatar for Galaxie 14. Galaxie Lv 1 57 pts. 10,683
  5. Avatar for Phyx 15. Phyx Lv 1 54 pts. 10,673
  6. Avatar for Deleted player 16. Deleted player pts. 10,673
  7. Avatar for anthion 17. anthion Lv 1 49 pts. 10,667
  8. Avatar for aznarog 18. aznarog Lv 1 47 pts. 10,649
  9. Avatar for silent gene 19. silent gene Lv 1 45 pts. 10,623
  10. Avatar for georg137 20. georg137 Lv 1 43 pts. 10,554

Comments