Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,444
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,434
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 10,156
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 10,063
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 10,026
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,917
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,904
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,863
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 9,473
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 9,448
  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 23 pts. 10,512
  2. Avatar for Glen B 32. Glen B Lv 1 22 pts. 10,501
  3. Avatar for diamonddays 33. diamonddays Lv 1 21 pts. 10,477
  4. Avatar for vuvuvu 34. vuvuvu Lv 1 20 pts. 10,465
  5. Avatar for christioanchauvin 35. christioanchauvin Lv 1 18 pts. 10,463
  6. Avatar for O Seki To 36. O Seki To Lv 1 17 pts. 10,444
  7. Avatar for Vinara 37. Vinara Lv 1 16 pts. 10,440
  8. Avatar for Norrjane 38. Norrjane Lv 1 15 pts. 10,434
  9. Avatar for Museka 39. Museka Lv 1 15 pts. 10,424
  10. Avatar for NinjaGreg 40. NinjaGreg Lv 1 14 pts. 10,414

Comments