Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 10,893
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,851
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,843
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,789
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,755
  6. Avatar for Contenders 6. Contenders 22 pts. 10,736
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,694
  8. Avatar for Russian team 8. Russian team 11 pts. 10,692
  9. Avatar for The Daydreamers 9. The Daydreamers 7 pts. 10,515
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 10,465

  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 23 pts. 10,512
  2. Avatar for Glen B 32. Glen B Lv 1 22 pts. 10,501
  3. Avatar for diamonddays 33. diamonddays Lv 1 21 pts. 10,477
  4. Avatar for vuvuvu 34. vuvuvu Lv 1 20 pts. 10,465
  5. Avatar for christioanchauvin 35. christioanchauvin Lv 1 18 pts. 10,463
  6. Avatar for O Seki To 36. O Seki To Lv 1 17 pts. 10,444
  7. Avatar for Vinara 37. Vinara Lv 1 16 pts. 10,440
  8. Avatar for Norrjane 38. Norrjane Lv 1 15 pts. 10,434
  9. Avatar for Museka 39. Museka Lv 1 15 pts. 10,424
  10. Avatar for NinjaGreg 40. NinjaGreg Lv 1 14 pts. 10,414

Comments