Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,444
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,434
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 10,156
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 10,063
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 10,026
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,917
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,904
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,863
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 9,473
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 9,448
  1. Avatar for Alistair69 41. Alistair69 Lv 1 13 pts. 10,402
  2. Avatar for joremen 42. joremen Lv 1 12 pts. 10,398
  3. Avatar for Idiotboy 43. Idiotboy Lv 1 11 pts. 10,393
  4. Avatar for cbwest 44. cbwest Lv 1 11 pts. 10,386
  5. Avatar for jamiexq 45. jamiexq Lv 1 10 pts. 10,385
  6. Avatar for rezaefar 46. rezaefar Lv 1 9 pts. 10,366
  7. Avatar for anthion 47. anthion Lv 1 9 pts. 10,347
  8. Avatar for pvc78 48. pvc78 Lv 1 8 pts. 10,321
  9. Avatar for alcor29 49. alcor29 Lv 1 8 pts. 10,304
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 7 pts. 10,276

Comments