Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,893
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,851
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,843
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,789
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,755
  6. Avatar for Contenders 6. Contenders 22 pts. 10,736
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,694
  8. Avatar for Russian team 8. Russian team 11 pts. 10,692
  9. Avatar for The Daydreamers 9. The Daydreamers 7 pts. 10,515
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 10,465
  1. Avatar for Alistair69 41. Alistair69 Lv 1 13 pts. 10,402
  2. Avatar for joremen 42. joremen Lv 1 12 pts. 10,398
  3. Avatar for Idiotboy 43. Idiotboy Lv 1 11 pts. 10,393
  4. Avatar for cbwest 44. cbwest Lv 1 11 pts. 10,386
  5. Avatar for jamiexq 45. jamiexq Lv 1 10 pts. 10,385
  6. Avatar for rezaefar 46. rezaefar Lv 1 9 pts. 10,366
  7. Avatar for anthion 47. anthion Lv 1 9 pts. 10,347
  8. Avatar for pvc78 48. pvc78 Lv 1 8 pts. 10,321
  9. Avatar for alcor29 49. alcor29 Lv 1 8 pts. 10,304
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 7 pts. 10,276

Comments