Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,444
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,434
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 10,156
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 10,063
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 10,026
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,917
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,904
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,863
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 9,473

  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 1 pt. 9,886
  2. Avatar for aspadistra 82. aspadistra Lv 1 1 pt. 9,863
  3. Avatar for Altercomp 83. Altercomp Lv 1 1 pt. 9,853
  4. Avatar for boondog 84. boondog Lv 1 1 pt. 9,835
  5. Avatar for Hero247 86. Hero247 Lv 1 1 pt. 9,811
  6. Avatar for kevin everington 87. kevin everington Lv 1 1 pt. 9,808
  7. Avatar for navn 88. navn Lv 1 1 pt. 9,795
  8. Avatar for xbp 89. xbp Lv 1 1 pt. 9,789
  9. Avatar for Vincera 90. Vincera Lv 1 1 pt. 9,785

Comments