Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,893
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,851
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,843
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,789
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,755
  6. Avatar for Contenders 6. Contenders 22 pts. 10,736
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,694
  8. Avatar for Russian team 8. Russian team 11 pts. 10,692
  9. Avatar for The Daydreamers 9. The Daydreamers 7 pts. 10,515
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 10,465
  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 1 pt. 9,886
  2. Avatar for aspadistra 82. aspadistra Lv 1 1 pt. 9,863
  3. Avatar for Altercomp 83. Altercomp Lv 1 1 pt. 9,853
  4. Avatar for boondog 84. boondog Lv 1 1 pt. 9,835
  5. Avatar for drumpeter18yrs9yrs 85. drumpeter18yrs9yrs Lv 1 1 pt. 9,834
  6. Avatar for Hero247 86. Hero247 Lv 1 1 pt. 9,811
  7. Avatar for kevin everington 87. kevin everington Lv 1 1 pt. 9,808
  8. Avatar for navn 88. navn Lv 1 1 pt. 9,795
  9. Avatar for xbp 89. xbp Lv 1 1 pt. 9,789
  10. Avatar for Vincera 90. Vincera Lv 1 1 pt. 9,785

Comments