Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,893
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,851
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,843
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,789
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,755
  6. Avatar for Contenders 6. Contenders 22 pts. 10,736
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,694
  8. Avatar for Russian team 8. Russian team 11 pts. 10,692
  9. Avatar for The Daydreamers 9. The Daydreamers 7 pts. 10,515
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 10,465
  1. Avatar for franzemanz 111. franzemanz Lv 1 1 pt. 9,346
  2. Avatar for slandrum 112. slandrum Lv 1 1 pt. 8,130
  3. Avatar for bzambrano 113. bzambrano Lv 1 1 pt. 7,331
  4. Avatar for noahmiller 114. noahmiller Lv 1 1 pt. 6,418
  5. Avatar for 01010011111 115. 01010011111 Lv 1 1 pt. 5,183
  6. Avatar for bkoep 116. bkoep Lv 1 1 pt. 3,796
  7. Avatar for gdnskye 117. gdnskye Lv 1 1 pt. 3,796
  8. Avatar for lamoille 118. lamoille Lv 1 1 pt. 3,796

Comments