Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105

  1. Avatar for jobo0502 21. jobo0502 Lv 1 42 pts. 10,240
  2. Avatar for Anfinsen_slept_here 22. Anfinsen_slept_here Lv 1 40 pts. 10,235
  3. Avatar for Crossed Sticks 23. Crossed Sticks Lv 1 38 pts. 10,226
  4. Avatar for georg137 24. georg137 Lv 1 37 pts. 10,209
  5. Avatar for Blipperman 25. Blipperman Lv 1 35 pts. 10,201
  6. Avatar for Glen B 26. Glen B Lv 1 33 pts. 10,160
  7. Avatar for Threeoak 27. Threeoak Lv 1 32 pts. 10,149
  8. Avatar for NewZealand 28. NewZealand Lv 1 30 pts. 10,105
  9. Avatar for hansvandenhof 29. hansvandenhof Lv 1 29 pts. 10,105
  10. Avatar for TastyMunchies 30. TastyMunchies Lv 1 27 pts. 10,079

Comments