Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105

  1. Avatar for Bletchley Park 31. Bletchley Park Lv 1 26 pts. 10,070
  2. Avatar for aznarog 32. aznarog Lv 1 25 pts. 10,063
  3. Avatar for guineapig 33. guineapig Lv 1 23 pts. 10,011
  4. Avatar for WBarme1234 34. WBarme1234 Lv 1 22 pts. 10,009
  5. Avatar for Merf 35. Merf Lv 1 21 pts. 10,000
  6. Avatar for kitek314_pl 36. kitek314_pl Lv 1 20 pts. 9,972
  7. Avatar for Hellcat6 37. Hellcat6 Lv 1 19 pts. 9,972
  8. Avatar for phi16 38. phi16 Lv 1 18 pts. 9,969
  9. Avatar for drumpeter18yrs9yrs 39. drumpeter18yrs9yrs Lv 1 17 pts. 9,948
  10. Avatar for Idiotboy 40. Idiotboy Lv 1 16 pts. 9,941

Comments