Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105

  1. Avatar for gurch 61. gurch Lv 1 4 pts. 9,432
  2. Avatar for Datstandin 62. Datstandin Lv 1 4 pts. 9,414
  3. Avatar for alcor29 63. alcor29 Lv 1 4 pts. 9,365
  4. Avatar for Pawel Tluscik 64. Pawel Tluscik Lv 1 4 pts. 9,353
  5. Avatar for NotJim99 65. NotJim99 Lv 1 3 pts. 9,324
  6. Avatar for Altercomp 66. Altercomp Lv 1 3 pts. 9,293
  7. Avatar for rezaefar 67. rezaefar Lv 1 3 pts. 9,272
  8. Avatar for rinze 68. rinze Lv 1 3 pts. 9,260
  9. Avatar for darioarena 69. darioarena Lv 1 2 pts. 9,258
  10. Avatar for kevin everington 70. kevin everington Lv 1 2 pts. 9,199

Comments