1743: Revisiting Puzzle 73: Polycystein
Closed since over 6 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- October 09, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA