Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,063
  2. Avatar for Contenders 12. Contenders 1 pt. 8,614
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,478
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,465
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,883

  1. Avatar for bolloforbio 91. bolloforbio Lv 1 1 pt. 8,109
  2. Avatar for Simek 92. Simek Lv 1 1 pt. 8,090
  3. Avatar for garfi 93. garfi Lv 1 1 pt. 8,086
  4. Avatar for gurch 94. gurch Lv 1 1 pt. 8,070
  5. Avatar for SiliconDioxide 95. SiliconDioxide Lv 1 1 pt. 8,066
  6. Avatar for Seikarii 96. Seikarii Lv 1 1 pt. 8,039
  7. Avatar for Anamfija 97. Anamfija Lv 1 1 pt. 8,020
  8. Avatar for Dagal 98. Dagal Lv 1 1 pt. 8,019
  9. Avatar for jdmclure 99. jdmclure Lv 1 1 pt. 7,931
  10. Avatar for fordesk 100. fordesk Lv 1 1 pt. 7,910

Comments


LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.