Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,063
  2. Avatar for Contenders 12. Contenders 1 pt. 8,614
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,478
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,465
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,883

  1. Avatar for SyntaxErr_ 101. SyntaxErr_ Lv 1 1 pt. 7,884
  2. Avatar for 121710101032 102. 121710101032 Lv 1 1 pt. 7,883
  3. Avatar for 1735 103. 1735 Lv 1 1 pt. 7,878
  4. Avatar for octavien 104. octavien Lv 1 1 pt. 7,846
  5. Avatar for RedEight 105. RedEight Lv 1 1 pt. 7,781
  6. Avatar for AymanRN 106. AymanRN Lv 1 1 pt. 7,772
  7. Avatar for laundryfolding 107. laundryfolding Lv 1 1 pt. 7,635
  8. Avatar for halogrunt2 108. halogrunt2 Lv 1 1 pt. 7,246
  9. Avatar for jtscott 109. jtscott Lv 1 1 pt. 7,035
  10. Avatar for heyubob 110. heyubob Lv 1 1 pt. 7,026

Comments


LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.