Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,063
  2. Avatar for Contenders 12. Contenders 1 pt. 8,614
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,478
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,465
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,883

  1. Avatar for Deleted player 21. Deleted player pts. 9,538
  2. Avatar for silent gene 22. silent gene Lv 1 37 pts. 9,533
  3. Avatar for TastyMunchies 23. TastyMunchies Lv 1 35 pts. 9,523
  4. Avatar for jobo0502 24. jobo0502 Lv 1 33 pts. 9,521
  5. Avatar for vakobo 25. vakobo Lv 1 31 pts. 9,511
  6. Avatar for MicElephant 26. MicElephant Lv 1 30 pts. 9,498
  7. Avatar for DoctorSockrates 27. DoctorSockrates Lv 1 28 pts. 9,459
  8. Avatar for Glen B 28. Glen B Lv 1 26 pts. 9,450
  9. Avatar for aznarog 29. aznarog Lv 1 25 pts. 9,426
  10. Avatar for NinjaGreg 30. NinjaGreg Lv 1 24 pts. 9,422

Comments


LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.