Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,063
  2. Avatar for Contenders 12. Contenders 1 pt. 8,614
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,478
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,465
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,883

  1. Avatar for Vincera 41. Vincera Lv 1 12 pts. 9,226
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 11 pts. 9,211
  3. Avatar for Hellcat6 43. Hellcat6 Lv 1 11 pts. 9,198
  4. Avatar for fpc 44. fpc Lv 1 10 pts. 9,173
  5. Avatar for heather-1 45. heather-1 Lv 1 9 pts. 9,159
  6. Avatar for Idiotboy 46. Idiotboy Lv 1 9 pts. 9,120
  7. Avatar for cbwest 47. cbwest Lv 1 8 pts. 9,113
  8. Avatar for bobcat 48. bobcat Lv 1 8 pts. 9,080
  9. Avatar for vuvuvu 49. vuvuvu Lv 1 7 pts. 9,063
  10. Avatar for id566488 50. id566488 Lv 1 7 pts. 9,056

Comments


LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.